DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl2 and CG42853

DIOPT Version :9

Sequence 1:NP_001246964.1 Gene:Rtnl2 / 40903 FlyBaseID:FBgn0015831 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001189128.1 Gene:CG42853 / 10178880 FlyBaseID:FBgn0262100 Length:284 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:115/220 - (52%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IFMDLKNLLLWRNSRKTLIVFTGILLLLLDVMVHSVISVISMVGITVLIAAIGHRLLVQFWSIWK 79
            |:..:..|:||||..|:::||..:..::.|::...::.|:|:..:.:::.::|:|.|||:.:...
  Fly    25 IWEGITELILWRNWIKSMLVFVMLQTIIYDLLSEPLVFVVSVWALIIMVISMGYRFLVQYTNTHI 89

  Fly    80 KDENKDQILRFYPHPKIEIPREETLYLAGKAVSHINLILNRMIELLLVEKWEDSLKFLVLLCGIN 144
            ::.:..:.|........|:.::..:.::.|.|:    .||.:.|:|||:.:..|.|:..||..|:
  Fly    90 QNNSYPKYLDIDLRISQELSKQLGVLVSTKVVA----FLNNLREILLVKSFSKSFKWFGLLLIIS 150

  Fly   145 LLGDCFNGLTLLIFGHLFIFTVPKLYESYKPFVD-VQIRKFRK----CKIDKS-NVEKPICIQ-- 201
            .||...|.|.:...|...:||:||:.|..:...: ||:.||.|    .|::.| ..:..:.::  
  Fly   151 KLGKQINFLIVGQLGLFLLFTIPKMCEMNRRSSNIVQLPKFNKQYQITKVNASTETQNALDMESL 215

  Fly   202 KECPPESAYEGQESKEGKVLYEPCD 226
            |||..::....::..||..|...||
  Fly   216 KECNEDTIKLIEKQPEGMDLSLGCD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl2NP_001246964.1 Reticulon 21..183 CDD:280592 43/162 (27%)
CG42853NP_001189128.1 Reticulon 31..179 CDD:280592 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I1880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.