DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and ICME-LIKE1

DIOPT Version :10

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_173937.2 Gene:ICME-LIKE1 / 839153 AraportID:AT1G26120 Length:476 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:78/205 - (38%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RSGKVVGSEDCLYLNVYTKHFNESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYLMSRDVVYVLFN 173
            |...|.|.:....|::|..  ..|..|.||:.::.|||:..|...........|..||::....:
plant   181 RRSIVYGDQPRNRLDLYLP--KNSTGPKPVVAFVTGGAWIIGYKAWGSLLGQQLSERDIIVACID 243

  Fly   174 YRLCSLGFLSMPSGKL-DVPGNAGLHDQLLALQWVSQHIRNFNGDPQNITLFGESAGAASVHFMM 237
            ||       :.|.|.: |:     :.|....:.:|..||..:.|||..|.|.|:||||   |...
plant   244 YR-------NFPQGSISDM-----VKDASSGISFVCNHIAEYGGDPDRIYLMGQSAGA---HIAA 293

  Fly   238 CLPQAKGLFHKAIMMSG-----SMLSPWVNAPDSDGIFCRLATSAGYEGPAEEVPILEFLRNVNA 297
            |.     :..:.|..||     |..|..:||        ....|.||.       :|..:.:.::
plant   294 CT-----IVEQVIKESGEGDSVSWSSSQINA--------YFGLSGGYN-------LLNLVDHFHS 338

  Fly   298 EKLIGHDFIS 307
            ..|....|:|
plant   339 RGLYRSIFLS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 39..536 CDD:395084 51/205 (25%)
ICME-LIKE1NP_173937.2 Aes 195..441 CDD:440422 47/191 (25%)

Return to query results.
Submit another query.