DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and AADACL2

DIOPT Version :10

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_997248.2 Gene:AADACL2 / 344752 HGNCID:24427 Length:401 Species:Homo sapiens


Alignment Length:130 Identity:28/130 - (21%)
Similarity:56/130 - (43%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SGKVVGSEDCLYLNVYTKHF---NESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYL-----MSRD 166
            |.:.:...|..::::..:.:   .:||.....::|.:||.|..|.:.:..:  |:|     .:.|
Human    75 SDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAF--DFLNRWTANTLD 137

  Fly   167 VVYVLFNYRLCSLGFLSMPSGKLDVPGNAGLHDQLLALQW--VSQHIRNFNGDPQNITLFGESAG 229
            .|.|..:|||.       |.....    |...|.|.|:::  :.:.:..:..||..|.:.|:|:|
Human   138 AVVVGVDYRLA-------PQHHFP----AQFEDGLAAVKFFLLEKILTKYGVDPTRICIAGDSSG 191

  Fly   230  229
            Human   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 39..536 CDD:395084 28/130 (22%)
AADACL2NP_997248.2 Abhydrolase_3 107..372 CDD:400284 24/98 (24%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 111..113 0/1 (0%)

Return to query results.
Submit another query.