DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and Nceh1

DIOPT Version :10

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_848887.1 Gene:Nceh1 / 320024 MGIID:2443191 Length:408 Species:Mus musculus


Alignment Length:182 Identity:42/182 - (23%)
Similarity:65/182 - (35%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SQLADPWN-SELDAR----------------QERPIPL---------QMDRRSGKVVGSE---DC 119
            |.::|||. ..|||.                ....|.|         |..|.|.||..::   |.
Mouse    25 SAVSDPWKLMLLDATFRGAQQVSNLIHSLGLNHHLIALNFIITSFGKQSARSSPKVKVTDTDFDG 89

  Fly   120 LYLNVYTKHFNESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYLMSR-----DVVYVLFNYRLCSL 179
            :.:.|:.......||....::||:||.:....|..|.|  |.|.:.     :.|.|...|||...
Mouse    90 VEVRVFEGSPKPEEPLRRSVIYIHGGGWALASAKISYY--DQLCTTMAEELNAVIVSIEYRLVPQ 152

  Fly   180 GFLSMPSGKLDVPGNAGLHDQLLALQWVSQH--IRNFNGDPQNITLFGESAG 229
            .:..           ..:||.:.|.::..|.  :..:..||..:.:.|:|||
Mouse   153 VYFP-----------EQIHDVIRATKYFLQPEVLDKYKVDPGRVGISGDSAG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 39..536 CDD:395084 42/182 (23%)
Nceh1NP_848887.1 Abhydrolase_3 109..381 CDD:400284 24/98 (24%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115 0/1 (0%)

Return to query results.
Submit another query.