DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and Nceh1

DIOPT Version :10

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001120996.1 Gene:Nceh1 / 294930 RGDID:1311104 Length:408 Species:Rattus norvegicus


Alignment Length:182 Identity:40/182 - (21%)
Similarity:66/182 - (36%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SQLADPWNSEL------DARQERP----------------IPLQMDRRSG------KVVGSE-DC 119
            |.::|||...|      .|:|...                |.:...::|.      ||..:: |.
  Rat    25 SAVSDPWKLMLLDATFRGAQQVSNLIHSLGLSHHLITLNFIIISFGKKSARSSPRVKVTDTDFDG 89

  Fly   120 LYLNVYTKHFNESEPPLPVMVYIYGGAFRTGGAVKSKYGPDYLMSR-----DVVYVLFNYRLCSL 179
            :.:.|:.......||....:|||:||.:....|..|.|  |.|.:.     :.|.|...|||...
  Rat    90 VEVRVFEGPPKPDEPLRRSVVYIHGGGWALASAKISYY--DQLCTAMAEELNAVIVSIEYRLVPQ 152

  Fly   180 GFLSMPSGKLDVPGNAGLHDQLLALQWVSQH--IRNFNGDPQNITLFGESAG 229
            .:..           ..:||.:.|.::..|.  :..:..||..:.:.|:|||
  Rat   153 VYFP-----------EQIHDVIRATKYFLQPEVLDKYKVDPGRVGVSGDSAG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 39..536 CDD:395084 40/182 (22%)
Nceh1NP_001120996.1 Abhydrolase_3 109..381 CDD:400284 25/98 (26%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115 0/1 (0%)

Return to query results.
Submit another query.