DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and Aadacl4fm4

DIOPT Version :10

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001078973.1 Gene:Aadacl4fm4 / 230890 MGIID:2685282 Length:407 Species:Mus musculus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:49/119 - (41%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MVYIYGGAFRTGGAVKSKYGPDYLMSRDVVYVLFNYR-------LCSLGFLSMPSGKLDVPGNAG 196
            :::.:|||...|             |.|:.:.|.::.       |.|:|:..:|  |...|  |.
Mouse   115 IIFYHGGAAAFG-------------SLDIYHNLCSFLVRETDSVLLSVGYRKLP--KHHHP--AA 162

  Fly   197 LHDQLLALQWVSQHIRNFNGDPQNITLFGESAG---AASVHFMM----CLPQAK 243
            |:|.|.|.....:.:..:..||..:.|.|:|.|   .||:...:    .|||.:
Mouse   163 LNDCLSATILFLKALETYGVDPSRVVLCGDSFGGWVVASISQTLVSTPSLPQIR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 39..536 CDD:395084 29/119 (24%)
Aadacl4fm4NP_001078973.1 alpha/beta hydrolases 115..378 CDD:473884 29/119 (24%)

Return to query results.
Submit another query.