DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est6 and cest-12

DIOPT Version :9

Sequence 1:NP_524262.1 Gene:alpha-Est6 / 40902 FlyBaseID:FBgn0015574 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_499576.4 Gene:cest-12 / 176642 WormBaseID:WBGene00013540 Length:850 Species:Caenorhabditis elegans


Alignment Length:232 Identity:81/232 - (34%)
Similarity:122/232 - (52%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VKLSVGSVKGRRL------SGIYGDEFYSFEGIPFAKPPLGKARFVASQLADPWNSEL-DARQER 100
            |..|.|||:||::      |.:|..:..:|.|||:.:.|:|..|....|..:.:|:.| ||...|
 Worm    37 VSCSQGSVQGRQVNLGNDQSQLYSGQANAFTGIPYCQAPVGNLRLQPPQPLNQFNTTLHDATYFR 101

  Fly   101 PIPLQMDRRSGKVVGSEDCLYLNVYTKHFNESEPPLPVMVYIYG-GAFRTGGAVKS--KYGPDYL 162
            |...|:: ..|..  :||||||||||.....:...|.|:|.|.| ..|..||..::  |.....|
 Worm   102 PKCPQLN-AGGPT--NEDCLYLNVYTPQAGNTNANLSVLVLIDGSNGFSNGGCDQNQEKGIISNL 163

  Fly   163 MSRDVVYVLFNYRLCSLGFLSMPSGKLDVPGNAGLHDQLLALQWVSQHIRNFNGDPQNITLFGES 227
            :.|.:|.|...||:.:|||.:..:.  .|..|.|:.||:.|::|:...|.||.|:|..||:.|:.
 Worm   164 VQRQIVVVTMQYRIGALGFFTTYTN--SVQSNLGMLDQVQAMRWIKTEIVNFGGNPNQITVAGQD 226

  Fly   228 AGAASVHFMMCLPQAKGLFHKAIMMSGSMLSPWVNAP 264
            .||.:|......|.::.||::||:.|||:.|.:...|
 Worm   227 DGACAVSAHCLSPMSQNLFNQAIVQSGSVYSCYNPTP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est6NP_524262.1 COesterase 35..534 CDD:278561 81/232 (35%)
Aes <133..325 CDD:223730 46/135 (34%)
cest-12NP_499576.4 Abhydrolase 37..>400 CDD:389770 81/232 (35%)
Abhydrolase <678..774 CDD:389770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.