DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est7 and Bche

DIOPT Version :9

Sequence 1:NP_524261.1 Gene:alpha-Est7 / 40901 FlyBaseID:FBgn0015575 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:580 Identity:169/580 - (29%)
Similarity:270/580 - (46%) Gaps:91/580 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RQSTNETVVADTEYGQVRGIKRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIPWERV----- 85
            :..|.|.|:..|:.|:|||:. :.:......:|.||||||||:|.||||.||....|..|     
  Rat    20 KSHTEEDVIITTKTGRVRGLS-MPILGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDVYNATK 83

  Fly    86 --RDCSQPKDKAVQVQFVFDKVEG----------SEDCLYLNVYTNNVKPDKARPVMVWIHGGGF 138
              ..|.|..|:|      |...:|          |||||||||:....||..| .||||::||||
  Rat    84 YANSCYQNIDQA------FPGFQGSEMWNPNTNLSEDCLYLNVWIPVPKPKNA-TVMVWVYGGGF 141

  Fly   139 IIGEANREWYGPDYFMK-EDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNC 202
            ..|.::...|...:..: |.|::|::.||:|||||::... ....|||.||.||.|||:||:.|.
  Rat   142 QTGTSSLPVYDGKFLTRVERVIVVSMNYRVGALGFLAFPG-NSEAPGNMGLFDQQLALQWIQRNI 205

  Fly   203 ASFGGDPNCITVFGESAGGASTHYMMLTDQTQGLFHRGILQSGSAICPWA--YNGDITHNPYRIA 265
            |:|||:|..:|:||||||.||....:|..|:..||.|.||:|||:..|||  :..:..:....:|
  Rat   206 AAFGGNPKSVTLFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLA 270

  Fly   266 KLVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFAFGPSLE-PFSTPECVISKP 329
            |.:|. .::|:|:::..|::...::::..|:.||..:...:   ..|||::: .|      ::..
  Rat   271 KFIGC-SKENEKEIITCLRSKDPQEILLNEKLVLPSDSIRS---INFGPTVDGDF------LTDM 325

  Fly   330 PKEMMKTAWSNSIPMFIGNTSYEGLLWVPEVKLMPQVLQQLDAGTPFIPKE---LLATEPSKEKL 391
            |..:::.....:..:.:|....||..:             |..|.|...|:   |:.....:|.|
  Rat   326 PHTLLQLGKVKTAQILVGVNKDEGTAF-------------LVYGAPGFSKDNDSLITRREFQEGL 377

  Fly   392 DSWSAQIRDVHRTG---------SESTPDNYM----DLCSIYYFVFPALRVVHSRHAYAAGAPVY 443
            :.:...:..:.:..         .:.||:.|.    |:...|..:.|||............|  :
  Rat   378 NMYFPGVSSLGKEAILFYYVDWLGDQTPEVYREAFDDIIGDYNIICPALEFTKKFAELEINA--F 440

  Fly   444 FYRYDFDSEELIFPYRIMRLGRGVKGVSHADDLSYQFSSLLARRLPKESRE---YRNIERTVGIW 505
            ||.::..|.:|.:|..:        ||.|..::.:.|...|.||:.....|   .|:|.:|   |
  Rat   441 FYYFEHRSSKLPWPEWM--------GVMHGYEIEFVFGLPLERRVNYTRAEEIFSRSIMKT---W 494

  Fly   506 TQFAATGNPYSEKINGMDTLTIDPVRKSDEVIKCLNISDDLKFIDLP-EWPKLKVWESLY 564
            ..||..|:|...:.|.    |:.||..|.|. |.|.::.:...|:.. ..|:.:.|...:
  Rat   495 ANFAKYGHPNGTQGNS----TVWPVFTSTEQ-KYLTLNTEKSKINSKLRAPQCQFWRLFF 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est7NP_524261.1 COesterase 27..514 CDD:278561 157/526 (30%)
Aes <116..>221 CDD:223730 48/105 (46%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 168/573 (29%)
Aes <120..>272 CDD:223730 65/153 (42%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.