DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est7 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_524261.1 Gene:alpha-Est7 / 40901 FlyBaseID:FBgn0015575 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:331 Identity:63/331 - (19%)
Similarity:123/331 - (37%) Gaps:92/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TVVADTEYG---------QVRGIKRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIPWERVRD 87
            ::||...||         .:..:|...:|.:.....|.:.|.|  .|:|.|:       |:..  
Zfish    26 SLVAQWLYGWPNKPGYQKYIEALKPRRIYCLARAVLEMLKYLQ--YGKLYFQ-------WKLW-- 79

  Fly    88 CSQPKDKAVQVQFVFDKVEGSEDCLYLNVYTN---NVKPDKARPVMVWIHGGGFIIGEANREWYG 149
            .|..|:....|:.:.....|::    |::|.:   .:..:...||:|:::||.:  |..:|..| 
Zfish    80 YSNDKNNKHYVKGITFGRRGNK----LDLYYSPRLELSDESPVPVVVFVYGGAW--GSGDRSIY- 137

  Fly   150 PDYFMKEDVVLVTIQY--RLGALGFMSLKSPELNV--PGNA-----GLKDQVLALKWIKNNCASF 205
                     .|:.:|.  .|.|    |:..|:.::  .||.     .:.|.:|   |::....:|
Zfish   138 ---------CLLALQMAKELNA----SVICPDYSIYPKGNVLNMVQDISDSLL---WVRQKGHAF 186

  Fly   206 GGDPNCITVFGESAGG--ASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNGDITHNPYR--IAK 266
            ..|.:.|.:.|.|||.  .:...:.|....:.||                   |..|..:  :..
Zfish   187 SLDQDNIILIGHSAGAHLCALTSLFLASNVEELF-------------------IETNKQKDLVTA 232

  Fly   267 LVGYKGEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFAFGPSLEPFS--TPECVISKP 329
            :.|..|......:::...:.|    :|..|.|.|:.:.|:        .:|.|.  :|..::.|.
Zfish   233 IKGIIGLSGVYSIMDHYNHEK----VRAVEYVSTMHKAMD--------GVENFDYYSPTSLLKKM 285

  Fly   330 PKEMMK 335
            .::.:|
Zfish   286 KEDQLK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est7NP_524261.1 COesterase 27..514 CDD:278561 63/331 (19%)
Aes <116..>221 CDD:223730 26/116 (22%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 48/259 (19%)
Abhydrolase 121..>210 CDD:304388 24/107 (22%)
Abhydrolase 167..336 CDD:304388 28/159 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.