DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est7 and CEL

DIOPT Version :9

Sequence 1:NP_524261.1 Gene:alpha-Est7 / 40901 FlyBaseID:FBgn0015575 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens


Alignment Length:530 Identity:157/530 - (29%)
Similarity:225/530 - (42%) Gaps:112/530 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TEYGQVRGI-KRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIP---WERVRDCSQPKDKAVQ 97
            ||.|.|.|: |:|.|.......|:|||:|.|.      ||.:.|.|   |:........|.:.:|
Human    28 TEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPT------KALENPQPHPGWQGTLKAKNFKKRCLQ 86

  Fly    98 VQFVFDKVEGSEDCLYLNVYTNNVKPDKAR--PVMVWIHGGGFIIGEA-------NREWYGPDYF 153
            .....|...|.|||||||::....:...:|  |||:||:||.|::|..       |..:.|.:..
Human    87 ATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIA 151

  Fly   154 MKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCITVFGES 218
            .:.:|::||..||:|.|||:|  :.:.|:|||.||:||.:|:.|:|.|.|:||||||.||:||||
Human   152 TRGNVIVVTFNYRVGPLGFLS--TGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGES 214

  Fly   219 AGGASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNGDITHNPYRIAKLVGYKGEDNDKDVLEFL 283
            |||||.....|:...:||..|.|.|||.|:.||.    |..||...||.|..|......|.....
Human   215 AGGASVSLQTLSPYNKGLIRRAISQSGVALSPWV----IQKNPLFWAKKVAEKVGCPVGDAARMA 275

  Fly   284 QNVKAKDLIRVEENVLTLEERMNKIMFA-----------FGPSLEPFSTPECVISKPPKEMMKTA 337
            |.:|..|     ...|||   ..|:..|           |.|.::....|...|:         .
Human   276 QCLKVTD-----PRALTL---AYKVPLAGLEYPMLHYVGFVPVIDGDFIPADPIN---------L 323

  Fly   338 WSNS--IPMFIGNTSYEGLLW----VPEVKLMPQVLQQLD----------------AGTPF-IPK 379
            ::|:  |....|..:.:|.::    :|.:....:.:.:.|                |.|.| :..
Human   324 YANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYT 388

  Fly   380 ELLATEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAYAAGAPVYF 444
            |..|.:||:                  |:.....:|..:...|:.|....:....|.|..|..|.
Human   389 ESWAQDPSQ------------------ENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYA 435

  Fly   445 YRYDFDSEELIFPYRIMRLGRGVKGVSHADDLSYQFSSLLARRLPKESREYRNIERTV-----GI 504
            |.:...|...::|..:        |..||||:.|.|....|     ....||..:|||     ..
Human   436 YLFSHPSRMPVYPKWV--------GADHADDIQYVFGKPFA-----TPTGYRPQDRTVSKAMIAY 487

  Fly   505 WTQFAATGNP 514
            ||.||.||:|
Human   488 WTNFAKTGDP 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est7NP_524261.1 COesterase 27..514 CDD:278561 156/528 (30%)
Aes <116..>221 CDD:223730 48/113 (42%)
CELNP_001798.3 Heparin-binding 21..121 32/98 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.