DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and UBC11

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_014984.3 Gene:UBC11 / 854517 SGDID:S000005866 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:45/144 - (31%)
Similarity:72/144 - (50%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPPK 67
            |:||..||..|:.:...::......|..|..|.|.:. |:..||:...|::.:.||..|||.||.
Yeast    10 TKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPM 74

  Fly    68 ILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVRE 132
            |.|.:.::|||||:.|.:||.|:. :.|......|.:|.:|.:::..|....||.:..||.:..:
Yeast    75 IKFLSPMWHPNVDKSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDAD 138

  Fly   133 HKKFMKTAEEFTKK 146
                   .||:.||
Yeast   139 -------MEEYRKK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 45/144 (31%)
UBCc 6..149 CDD:214562 44/142 (31%)
UBC11NP_014984.3 COG5078 11..156 CDD:227410 44/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.