DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and UBC4

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_009638.1 Gene:UBC4 / 852376 SGDID:S000000286 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:55/149 - (36%)
Similarity:86/149 - (57%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMW-TGLLVPEKAPYNKGAFRIEINFPPQYPFM 64
            |::::|:.:||||| |....|..:.....:.|..| ..::.|..:||..|.|.:.|:||..|||.
Yeast     1 MSSSKRIAKELSDL-ERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFK 64

  Fly    65 PPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEF 129
            ||||.|.|||||||::..|.:||.|:. |.|.|.....:||.::.:::.:..|:.||..::|..:
Yeast    65 PPKISFTTKIYHPNINANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIY 128

  Fly   130 VREHKKFMKTAEEFTKKNA 148
            ..:..|:..||.|:|||.|
Yeast   129 KTDRPKYEATAREWTKKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 55/149 (37%)
UBCc 6..149 CDD:214562 54/144 (38%)
UBC4NP_009638.1 UBCc 3..147 CDD:412187 53/145 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.