DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CDC34

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:49/162 - (30%)
Similarity:83/162 - (51%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLTRELSDLVEAKMSTLRNIESSDES-LLMWT-GLLV-PEKAPYNKGAFRIEINFPPQYPFMPPK 67
            |..|||:|..:|..|.  :||..|:| :..|. |::| .|.:.|:.|.|:.::.||..:||.||:
Yeast    14 RQYRELTDPKKAIPSF--HIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQ 76

  Fly    68 ILFKTKIYHPNVDEKGEVCLPII-----------STDNWKPTTRTEQVLQALVAIVHNPEPEHPL 121
            ..|...||||||...|.:|:.|:           ..:.|.|....|.||.::|:::.:|....|.
Yeast    77 FRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPA 141

  Fly   122 RSDLAEEFVR---EHKKFMKTAEEFTKKNAEK 150
            ..|.|.::.:   ::|:.:|...|.:|::..|
Yeast   142 NVDAAVDYRKNPEQYKQRVKMEVERSKQDIPK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 48/160 (30%)
UBCc 6..149 CDD:214562 48/159 (30%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 48/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.