DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and UBC9

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_010219.1 Gene:UBC9 / 851495 SGDID:S000002222 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:37/129 - (28%)
Similarity:65/129 - (50%) Gaps:8/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IESSDES--LLMW-TGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVC 86
            ::.:|.|  |..| .|:...|...:..|.:.|.:.:|.:||..|||:.|....|||||...|.:|
Yeast    29 VKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTIC 93

  Fly    87 LPIISTD-NWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVRE----HKKFMKTAEEFTK 145
            |.|::.| :|:|....:|::..:..::.:|.|..|.:......|.|.    .||.:..|::::|
Yeast    94 LSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKAEYDKKVLLQAKQYSK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 37/129 (29%)
UBCc 6..149 CDD:214562 37/129 (29%)
UBC9NP_010219.1 COG5078 1..157 CDD:227410 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.