DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and UBE2L3

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001243284.1 Gene:UBE2L3 / 7332 HGNCID:12488 Length:212 Species:Homo sapiens


Alignment Length:154 Identity:94/154 - (61%)
Similarity:122/154 - (79%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRL--TRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPF 63
            :|..||.  ..||.::.:..|...|||:..:.:||.|.||:||:..||:|||||||||||.:|||
Human    57 LAGYRRAHGPEELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPF 121

  Fly    64 MPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEE 128
            .||||.|||||||||:||||:||||:||.:||||.|:|:||:|:|:|:|::|:||||||:|||||
Human   122 KPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEE 186

  Fly   129 FVREHKKFMKTAEEFTKKNAEKRP 152
            :.::.|||.|.|||||||..||||
Human   187 YSKDRKKFCKNAEEFTKKYGEKRP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 90/150 (60%)
UBCc 6..149 CDD:214562 88/144 (61%)
UBE2L3NP_001243284.1 COG5078 67..208 CDD:227410 87/140 (62%)
UBCc 67..207 CDD:214562 87/139 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.