DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ube2l6

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_064333.2 Gene:Ube2l6 / 56791 MGIID:1914500 Length:153 Species:Mus musculus


Alignment Length:152 Identity:71/152 - (46%)
Similarity:98/152 - (64%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMP 65
            |.|::|:.:||..|.:.....||.:.|.|.::|:|..||:|::.||...||::.|:||.:|||.|
Mouse     1 MMASKRVAKELESLSKELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFKP 65

  Fly    66 PKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFV 130
            |.:.|.||||||||.|.|.||||:||.:||||.|:..|||:||..:|..|..|.|:|.:||:...
Mouse    66 PTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLT 130

  Fly   131 REHKKFMKTAEEFTKKNAEKRP 152
            :..:.|.|.|||||.|....||
Mouse   131 QNPEMFRKKAEEFTLKFGVDRP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 69/148 (47%)
UBCc 6..149 CDD:214562 67/142 (47%)
Ube2l6NP_064333.2 COG5078 1..147 CDD:227410 68/145 (47%)
UQ_con 6..144 CDD:278603 64/137 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.