DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and ube2e2

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001003494.1 Gene:ube2e2 / 445100 ZFINID:ZDB-GENE-040801-237 Length:201 Species:Danio rerio


Alignment Length:167 Identity:46/167 - (27%)
Similarity:87/167 - (52%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMST-LRNIES-----------------SDESLLMW-TGLLVPEKAPY 46
            :.|.::...::|....||:|| .:.|:.                 ..:::..| :.:|.|..:.|
Zfish    35 LVAPKKKETKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 99

  Fly    47 NKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAI 111
            ..|.|.::|.|.|.|||.|||:.|:|:|||.|::.:|.:||.|:. |||.|.....:||.::.::
Zfish   100 EGGVFFLDIAFTPDYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSL 163

  Fly   112 VHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNA 148
            :.:..|..||...:|.:::....:..:.|:::||:.|
Zfish   164 LTDCNPADPLVGSIATQYLTNRTEHDRIAKQWTKRYA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 46/167 (28%)
UBCc 6..149 CDD:214562 45/162 (28%)
ube2e2NP_001003494.1 UQ_con 59..196 CDD:395127 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.