DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and vih

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:43/151 - (28%)
Similarity:79/151 - (52%) Gaps:8/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AATRRLTRELSDLVEAKMSTLRNIES--SDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPF 63
            |.::||.:||.:|:   |:..|.|.:  ..|::..|.|.:. |....|:...:|:.::||..||:
  Fly    32 AVSKRLHKELMNLM---MANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPY 93

  Fly    64 MPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEE 128
            ..|.:.|.|..:|||||.:|.:||.|:. |.|........:|.::.:::..|..|.||.:..|..
  Fly    94 AAPVVKFLTSCFHPNVDLQGAICLDILK-DKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMM 157

  Fly   129 FVREHKKFMKTAEEFTKKNAE 149
            : .:.|::.|..:.|.:|:.:
  Fly   158 W-NDQKEYKKYLDAFYEKHKD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 43/151 (28%)
UBCc 6..149 CDD:214562 42/145 (29%)
vihNP_648582.1 COG5078 31..166 CDD:227410 40/138 (29%)
UQ_con 36..172 CDD:278603 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.