DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG10254

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster


Alignment Length:136 Identity:37/136 - (27%)
Similarity:60/136 - (44%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPP---KILFKTKIYHPNVDEKGEVCLPII 90
            |...||...::.|::.||....|..:..|...||..||   .|.:.|...:||:.|.|.||:.::
  Fly  1148 DRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLL 1212

  Fly    91 ST----DN--WKPTTRTEQVLQALVAIVHNPEP-------EHPLRSDLAEEFVREHKK--FMKTA 140
            .|    ||  |.|::...|||.::..::...||       |....:.|..|..|.:.:  .:|.|
  Fly  1213 GTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEPYYNEAGYEKQRGTQLGNENSRVYNEMAIIKIA 1277

  Fly   141 EEFTKK 146
            :...|:
  Fly  1278 QSTVKQ 1283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 37/136 (27%)
UBCc 6..149 CDD:214562 37/136 (27%)
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.