DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG5823

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:118 Identity:33/118 - (27%)
Similarity:49/118 - (41%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTRELSDLVEAKMSTLRNI--ESSDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPPKI 68
            ::|...|.:..|...|..|  |....::|.|...:. ||.:||..|.:...:.||.::||.||.|
  Fly    16 VSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGTLLFPREFPFKPPSI 80

  Fly    69 LFKTKIYHPN--VDEKGEVCLPI--ISTDNWKPTTRTEQVLQALVAIVHNPEP 117
            ...|    ||  ......:||.|  ...|.|.||.....:|..|::.:....|
  Fly    81 YMLT----PNGRFKTNTRLCLSISDFHPDTWNPTWCVGTILTGLLSFMLESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 33/118 (28%)
UBCc 6..149 CDD:214562 33/118 (28%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.