DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG14739

DIOPT Version :10

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:170 Identity:44/170 - (25%)
Similarity:72/170 - (42%) Gaps:30/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV----PEKAPYNKGAFRIEINFPPQYPF 63
            |.|||.|:::.|:.:...|     :.|:.:   |.|.|    |..:.|..|.:.:.:..|..||.
  Fly    14 AGRRLDRDVNRLLASGYRT-----TVDDDM---TNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPL 70

  Fly    64 MPPKILFKTKIYHPNVD-EKGEVCLPIISTDNWKPTTRTEQVLQA-LVAIVHNPEPEHPLRSDLA 126
            ..|::.|.|||.|||:: ..|.||:.::. ..|..:.....:.:. |..::..|.|...|....|
  Fly    71 TAPRVRFVTKILHPNIEFITGLVCMNVLK-QAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAA 134

  Fly   127 ------EEFVREHKKF-MKT--------AEEFTKKNAEKR 151
                  |:..|||... |||        ..:..::..|||
  Fly   135 AIMKHSEQLFREHVILCMKTYAMPANLPTRQLVEEGLEKR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 41/166 (25%)
CG14739NP_650151.1 UBCc_UBE2H 16..152 CDD:467417 37/144 (26%)

Return to query results.
Submit another query.