DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and UbcE2M

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:148 Identity:43/148 - (29%)
Similarity:68/148 - (45%) Gaps:18/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AATRRLTRELSDLVEAKMSTLRNIESSD----ESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYP 62
            ||..|:.:::::|      .|.|..::|    ..||.:..::.|::..|..|.|.........||
  Fly    26 AAQLRIQKDINEL------NLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYP 84

  Fly    63 FMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAE 127
            ..|||:...|::||||:|..|.|||.|:..| |.|......::..|..:...|.||.||..:.|:
  Fly    85 HEPPKVKCATQVYHPNIDLDGNVCLNILRED-WNPVLNINSIVYGLQFLFLEPNPEDPLNKEAAD 148

  Fly   128 -------EFVREHKKFMK 138
                   :|....||.|:
  Fly   149 VLQTNRRQFENNVKKAMR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 43/148 (29%)
UBCc 6..149 CDD:214562 41/144 (28%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.