DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Uev1A

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:83 Identity:22/83 - (26%)
Similarity:43/83 - (51%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IESSDE-SLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCL 87
            :|:.|: :|..|.|::: |.:.|:....:.::|....:||..||.:.|.||:   |::     | 
  Fly    37 LENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKV---NIN-----C- 92

  Fly    88 PIISTDNWKPTTRTEQVL 105
              |:.:|.....|:.|:|
  Fly    93 --INQNNGVVDHRSVQML 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 22/83 (27%)
UBCc 6..149 CDD:214562 22/83 (27%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.