DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG17030

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:153 Identity:64/153 - (41%)
Similarity:105/153 - (68%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMS-TLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFM 64
            |...:|:.|||:.::|.|.: ..||:.....::..|||||:|...||:|||:::||:||..|||.
  Fly     9 MDGPKRMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFK 73

  Fly    65 PPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEF 129
            ||:|...|::||.||:|:|:||:||:..::|.||||.:||||.|:|.:::|:||:....::|.|:
  Fly    74 PPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEY 138

  Fly   130 VREHKKFMKTAEEFTKKNAEKRP 152
            ..:..:|.|.|:.:.:|.:|.||
  Fly   139 RNDPVRFFKMADAWVQKYSEPRP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 61/149 (41%)
UBCc 6..149 CDD:214562 60/143 (42%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 60/145 (41%)
UQ_con 14..153 CDD:278603 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4246
Isobase 1 0.950 - 0 Normalized mean entropy S537
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.