DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ubc10

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:152 Identity:101/152 - (66%)
Similarity:132/152 - (86%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMP 65
            |.|.|||.:|||||....:.:.|:|::.|::||.||||:||:..||||||||||||||.:|||.|
  Fly     1 MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKP 65

  Fly    66 PKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFV 130
            |||.|||:|||||:||||:||||||||:||||.|||:||:||||.::::||||||||::|||||:
  Fly    66 PKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFL 130

  Fly   131 REHKKFMKTAEEFTKKNAEKRP 152
            ::.|||:|.||::|||::||||
  Fly   131 KDRKKFVKNAEDYTKKHSEKRP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 97/148 (66%)
UBCc 6..149 CDD:214562 94/142 (66%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 91/137 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439824
Domainoid 1 1.000 198 1.000 Domainoid score I1796
eggNOG 1 0.900 - - E2759_KOG0422
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I2287
Isobase 1 0.950 - 0 Normalized mean entropy S537
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 1 1.000 - - otm14393
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
1211.750

Return to query results.
Submit another query.