DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG4502

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:68/161 - (42%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TRRLTRELSDL--VEAKMSTLRNIESSDESLLMW---------TGLLVPEKAPYNKGAFRIEINF 57
            ||||.:|..::  ::||...:..:|..::||..|         ...|..:.|.....|..:.::|
  Fly   140 TRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSF 204

  Fly    58 PPQYPFMPPKILFKTKIYHPNVD-----EKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEP 117
            |..:||.||.:    ::..|:::     |.|.:|:.:::...|......|.|:....|.|...:.
  Fly   205 PDNFPFAPPFM----RVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVKGQG 265

  Fly   118 EHPLRSDLAEEFVREH-----KKFMKTAEEF 143
            ....:....:||.|..     :..:||.|::
  Fly   266 RIARKPKSTKEFTRRQAEESFRSLVKTHEKY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 35/161 (22%)
UBCc 6..149 CDD:214562 33/159 (21%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 27/121 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.