DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG2574

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:156 Identity:50/156 - (32%)
Similarity:79/156 - (50%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLTRELSDL-VEAKMSTLRNIESSDESLLMWT-GLLVPEKAPYNKGAFRIEINFPPQYPFMPPKI 68
            |:..||.|: .....:...::...|  ||.|| |:..|..:.|..|.||::|.||..|||..|:|
  Fly    66 RIKSELQDIRKNPPPNCTADLHHGD--LLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRI 128

  Fly    69 LFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREH 133
            .|.|:|||.|||.:|.:||.::. :.|.|.....:||.::..::....|:.||...:|:::....
  Fly   129 RFTTRIYHCNVDSRGAICLDVLG-ERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNR 192

  Fly   134 KKFMKTAEEFTK---------KNAEK 150
            ::..|.|..:||         ||.||
  Fly   193 REHDKIARHWTKLFAMTKAQDKNREK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 48/154 (31%)
UBCc 6..149 CDD:214562 48/153 (31%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/144 (32%)
UQ_con 66..203 CDD:278603 44/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.