DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and CG2924

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:128 Identity:32/128 - (25%)
Similarity:54/128 - (42%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATRRLTRELSDLV--EAKMSTLRNIESSDESLLMWTGLL--VPEKAPYN-----------KGAFR 52
            ||.||.:||.|:.  :|....:.:||..:||:..|...|  |...:|.:           |.:..
  Fly   223 ATDRLMKELRDIYRSDAFKKNMYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKDSIL 287

  Fly    53 IEINFPPQYPFMPPKILFKTKIYHPNVDE-----KGEVCLPIISTDNWKPTTRTEQVLQALVA 110
            :.|.|...|||.||.:    ::.||.:..     .|.:|:.:::...|......|.|:..:.|
  Fly   288 LNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQIAA 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 32/128 (25%)
UBCc 6..149 CDD:214562 30/125 (24%)
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.