DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ube2e3

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001041322.2 Gene:Ube2e3 / 295686 RGDID:1308894 Length:207 Species:Rattus norvegicus


Alignment Length:166 Identity:46/166 - (27%)
Similarity:84/166 - (50%) Gaps:20/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AATRRLTRELSDLVEAKMST-LRNIES-----------------SDESLLMW-TGLLVPEKAPYN 47
            |..::...:||....||:|| .:.|:.                 ..:::..| :.:|.|..:.|.
  Rat    42 ATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYE 106

  Fly    48 KGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIV 112
            .|.|.::|.|...|||.|||:.|:|:|||.|::.:|.:||.|:. |||.|.....:||.::.:::
  Rat   107 GGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLL 170

  Fly   113 HNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNA 148
            .:..|..||...:|.:::....:..:.|.::||:.|
  Rat   171 TDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 46/166 (28%)
UBCc 6..149 CDD:214562 45/162 (28%)
Ube2e3NP_001041322.2 UQ_con 65..202 CDD:395127 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.