DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and ubc14

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_594859.1 Gene:ubc14 / 2541565 PomBaseID:SPAC1250.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:53/149 - (35%)
Similarity:86/149 - (57%) Gaps:2/149 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AATRRLTRELSDLVEAKMSTLRNIESSDESLLMWT-GLLVPEKAPYNKGAFRIEINFPPQYPFMP 65
            :::||||:|.|||.|..:..:| :...|::|..|. ..|.|..:.|..|.|...:.||..|||.|
pombe     7 SSSRRLTKEYSDLREHPIPDIR-VNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQP 70

  Fly    66 PKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFV 130
            |.|.|.|:|||||.|.:|.|||.|:....:||:.:...||:.::.::..|.|:.||.:.:||::.
pombe    71 PTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYR 135

  Fly   131 REHKKFMKTAEEFTKKNAE 149
            .:...|.|.|.::.::.|:
pombe   136 NDRPSFDKIARDYVEQFAK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 53/149 (36%)
UBCc 6..149 CDD:214562 51/143 (36%)
ubc14NP_594859.1 COG5078 12..154 CDD:227410 50/142 (35%)
UQ_con 12..149 CDD:278603 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.