DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ube2l3

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_033482.1 Gene:Ube2l3 / 22195 MGIID:109240 Length:154 Species:Mus musculus


Alignment Length:152 Identity:97/152 - (63%)
Similarity:126/152 - (82%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMP 65
            |||:|||.:||.::.:..|...|||:..:.:||.|.||:||:..||:|||||||||||.:|||.|
Mouse     1 MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKP 65

  Fly    66 PKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFV 130
            |||.|||||||||:||||:||||:||.:||||.|:|:||:|:|:|:|::|:||||||:|||||:.
Mouse    66 PKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYS 130

  Fly   131 REHKKFMKTAEEFTKKNAEKRP 152
            ::.|||.|.|||||||..||||
Mouse   131 KDRKKFCKNAEEFTKKYGEKRP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 93/148 (63%)
UBCc 6..149 CDD:214562 89/142 (63%)
Ube2l3NP_033482.1 UBCc 6..149 CDD:214562 89/142 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51868
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106294
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.