DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ube2d1

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006513541.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:160 Species:Mus musculus


Alignment Length:143 Identity:49/143 - (34%)
Similarity:81/143 - (56%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPPKILF 70
            :.:|||||.....:........|: |..|...:: |..:.|..|.|.:.::||..|||.||||.|
Mouse    19 IQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAF 82

  Fly    71 KTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKK 135
            .|||||||::..|.:||.|:.: .|.|.....:||.::.:::.:|.|:.||..|:|:.:..:.:|
Mouse    83 TTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEK 146

  Fly   136 FMKTAEEFTKKNA 148
            :.:.|.|:|:|.|
Mouse   147 YNRHAREWTQKYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 49/143 (34%)
UBCc 6..149 CDD:214562 49/143 (34%)
Ube2d1XP_006513541.1 UBCc 19..159 CDD:381827 48/141 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.