DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and ubc-24

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_495769.2 Gene:ubc-24 / 186057 WormBaseID:WBGene00006719 Length:160 Species:Caenorhabditis elegans


Alignment Length:142 Identity:40/142 - (28%)
Similarity:77/142 - (54%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILF 70
            |:.:|::||.:.|...:::....::...::...::.:...|....|.:.::...:|||.||.:.|
 Worm    17 RIRKEIADLAKNKRRFIKDFRKIEKCKDIFQFKIIGDGVLYKNMIFTLTLDVNVEYPFKPPYLKF 81

  Fly    71 KTKIYHPNVDE-KGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHK 134
            ...:||||||. ..|:|.|::..:||||.|..|.||..|:.:::.|:...|:..|.|.:::....
 Worm    82 CHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVNIDAAHDYIHNKV 146

  Fly   135 KFMKTAEEFTKK 146
            :|:|.:.|..||
 Worm   147 EFVKKSTELAKK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 40/142 (28%)
UBCc 6..149 CDD:214562 40/142 (28%)
ubc-24NP_495769.2 UBCc 17..160 CDD:214562 40/142 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S537
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.