DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc84D and Ube2e1

DIOPT Version :9

Sequence 1:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_038949665.1 Gene:Ube2e1 / 100366017 RGDID:2324438 Length:310 Species:Rattus norvegicus


Alignment Length:149 Identity:44/149 - (29%)
Similarity:85/149 - (57%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATRRLTRELSDLVEAKMSTLRNIES--SDESLLMW-TGLLVPEKAPYNKGAFRIEINFPPQYPFM 64
            :.:|:.:||:|:.   :....|..:  ..:::..| :.:|.|..:.|..|.|.::|.|.|:|||.
  Rat   165 SAKRIQKELADIT---LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFK 226

  Fly    65 PPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEF 129
            |||:.|:|:|||.|::.:|.:||.|:. |||.|.....:||.::.:::.:..|..||...:|.::
  Rat   227 PPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 290

  Fly   130 VREHKKFMKTAEEFTKKNA 148
            :....:..:.|.::||:.|
  Rat   291 MTNRAEHDRMARQWTKRYA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 44/149 (30%)
UBCc 6..149 CDD:214562 44/146 (30%)
Ube2e1XP_038949665.1 PHA03378 <19..>108 CDD:223065
UQ_con 168..305 CDD:395127 41/140 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.