DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARRB2 and Arr1

DIOPT Version :9

Sequence 1:XP_011522160.1 Gene:ARRB2 / 409 HGNCID:712 Length:440 Species:Homo sapiens
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:346 Identity:152/346 - (43%)
Similarity:234/346 - (67%) Gaps:5/346 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    39 RVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLK-DRKVFVTLTCAFRYGREDLDV 102
            :||||.|||..:|:|:.:|||||.:.:|:|:||::::|.:|:: :||:||.|.|.|||||||.::
  Fly     6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEM 70

Human   103 LGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPED 167
            :||.|:|:|.:.:.|..||.....: .|::|:|||:|||.:|:||...:|.:.|.||.||....|
  Fly    71 IGLRFQKELTLVSQQVCPPQKQDIQ-LTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASD 134

Human   168 TGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLE 232
            ..:.|||.:.::.|...|..::||:|:::.|.|||||:||.|.|.||.....:.||:|...|.||
  Fly   135 ESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELE 199

Human   233 ASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDD--QVS 295
            .:|||:||:|||.::||:.|.|||.|.|||||..|:|..|:.||...|::..:|.:|..:  .::
  Fly   200 VTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLN 264

Human   296 PSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLV 360
            |.|:..||..:.|.|..|.::.|:|::|.:|.:||.|||:|::.....::..||:|||.|||||.
  Fly   265 PGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLF 329

Human   361 V-SRGGDVSVELPFVLMHPKP 380
            : :.||::..||||:||||||
  Fly   330 LGALGGELCAELPFILMHPKP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARRB2XP_011522160.1 Arrestin_N 50..206 CDD:278754 66/156 (42%)
Arrestin_C 225..380 CDD:214976 69/157 (44%)
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 66/156 (42%)
Arrestin_C 192..350 CDD:214976 69/157 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.