DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est8 and Bche

DIOPT Version :9

Sequence 1:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:560 Identity:160/560 - (28%)
Similarity:245/560 - (43%) Gaps:151/560 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SNDKVIADTVYGKVKGVKWQSIYGNNYYSFEGIPFAKPPVGELRFKAPVEPEHWSDVKRCTHVRA 93
            :.:.||..|..|:|:|:. ..|.|....:|.|||:|:||:|.||||.|.....|.||...|.. |
  Rat    23 TEEDVIITTKTGRVRGLS-MPILGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDVYNATKY-A 85

  Fly    94 KPCQVNI--VLKQVQG----------SEDCLYLNVYTRELHPHRPLP------VLVWIYGGGFQM 140
            ..|..||  .....||          |||||||||:.       |:|      |:||:||||||.
  Rat    86 NSCYQNIDQAFPGFQGSEMWNPNTNLSEDCLYLNVWI-------PVPKPKNATVMVWVYGGGFQT 143

  Fly   141 GEASRDLYSPDYI-MMEHVVLVVISYRLGALGFLSLADEELDVPGNAGLKDQVMALRWVKRNCQF 204
            |.:|..:|...:: .:|.|::|.::||:||||||:..... :.|||.||.||.:||:|::||...
  Rat   144 GTSSLPVYDGKFLTRVERVIVVSMNYRVGALGFLAFPGNS-EAPGNMGLFDQQLALQWIQRNIAA 207

  Fly   205 FGGDPDNITVFGESAGGASTHYMMLTDQAKGLFHKTIIMSGSALAPWA-QTPTHI-NWPYRLAQA 267
            |||:|.::|:||||||.||....:|..|:..||.:.|:.|||:.|||| :.|... |....||:.
  Rat   208 FGGNPKSVTLFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKF 272

  Fly   268 TGYTGDANDRDIFAHLKKCKASSMLKVAEDIITMEE---RHQRLTMFSFGPTIE-PYLT--PHCV 326
            .|.:.: |:::|...|:.       |..::|:..|:   ....:...:||||:: .:||  ||.:
  Rat   273 IGCSKE-NEKEIITCLRS-------KDPQEILLNEKLVLPSDSIRSINFGPTVDGDFLTDMPHTL 329

  Fly   327 IPKSPLEMMRDCWG-----NSIPMVIGGNSF--------------EGLLM-FPEVNKWPELLCQL 371
            :....::..:...|     .:..:|.|...|              |||.| ||.|:         
  Rat   330 LQLGKVKTAQILVGVNKDEGTAFLVYGAPGFSKDNDSLITRREFQEGLNMYFPGVS--------- 385

  Fly   372 GDCENLAPQDAHVDEQQRKAFGKKVRELYF----GDRTP-----------GRKTI----LEYSDL 417
                               :.||:....|:    ||:||           |...|    ||::..
  Rat   386 -------------------SLGKEAILFYYVDWLGDQTPEVYREAFDDIIGDYNIICPALEFTKK 431

  Fly   418 FS-------YKYFWHGIHRTLLSRAHHAPLAPTFLYRFDFDSKHFNIMRIITCGRKVRGTCHADD 475
            |:       :.||.|        |:...|. |.::                       |..|..:
  Rat   432 FAELEINAFFYYFEH--------RSSKLPW-PEWM-----------------------GVMHGYE 464

  Fly   476 LSYLFYNAAAKKLKRRTAEFKTIKRLVSMVVHFAISGDPN 515
            :.::|.....:::....||....:.::....:||..|.||
  Rat   465 IEFVFGLPLERRVNYTRAEEIFSRSIMKTWANFAKYGHPN 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 160/560 (29%)
Aes <116..>221 CDD:223730 48/111 (43%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 160/560 (29%)
Aes <120..>272 CDD:223730 67/159 (42%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.