DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est8 and cel.1

DIOPT Version :9

Sequence 1:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_955901.2 Gene:cel.1 / 322481 ZFINID:ZDB-GENE-030131-1201 Length:550 Species:Danio rerio


Alignment Length:560 Identity:166/560 - (29%)
Similarity:256/560 - (45%) Gaps:78/560 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GKVKGVKWQSIYGNNYY-SFEGIPFAKPPVGELRFKAPVEPEHWSDVKRCTHVRAKPCQVNIVLK 103
            |.|:| |.:|:....|. :|:|||||.||   .||:.||....|..|.:.|..|.:..|:|::..
Zfish    30 GMVQG-KSRSVGLFRYMDTFKGIPFAAPP---KRFEKPVAHPGWEGVLKTTDYRKRCLQLNLLAT 90

  Fly   104 QVQGSEDCLYLNVYT---RELHPHRPLPVLVWIYGGGFQMGEASRDLYSPDYI-----MME--HV 158
            .|.|||||||||::.   |.:..:  |||:|:||||.|.:|......:..:|:     |.:  :|
Zfish    91 DVIGSEDCLYLNIWVPQGRTVSSN--LPVMVFIYGGAFLLGGGQGANFLDNYLYDGEEMADRGNV 153

  Fly   159 VLVVISYRLGALGFLSLADEELDVPGNAGLKDQVMALRWVKRNCQFFGGDPDNITVFGESAGGAS 223
            ::|..:||:|||||:|..|:  .:|||.||.||..|:.||.||.:.|||:|||||:||||||.||
Zfish   154 IVVTFNYRVGALGFMSTGDD--GIPGNYGLWDQHAAISWVHRNIKAFGGNPDNITLFGESAGAAS 216

  Fly   224 THYMMLTDQAKGLFHKTIIMSGSALAPWAQTPTHINWPYRLAQATGYTGDANDRDIFAHLKKCKA 288
            .::.::|.:.||:..:.|..||.||.|||.:.....:...:|...|...|:...|.   ||:...
Zfish   217 VNFQIITPKNKGMIRRAISQSGVALCPWAISRNPRQFAEEIATKVGCPIDSGMADC---LKRADP 278

  Fly   289 SSMLKVAEDIITMEERHQRLTMFSFGPTIEP-YLTPHC---VIPKSPLEMMRDCWGNS--IPMVI 347
            .:        :|:..: .:||.....|.:.. ||:|..   .||..|    ...:||:  |..:.
Zfish   279 KA--------VTLAGK-LKLTSSPDAPIVHNLYLSPVIDGDFIPDEP----ETLFGNAADIDYIA 330

  Fly   348 GGNSFEGLLM----FPEVNKWPELLCQLGDCENLAP-------QDAHVDEQQRKAFGKKVRELYF 401
            |.|..:..:.    .|.:|. ......:.:.:.||.       |||.:...|...       :.:
Zfish   331 GVNDMDAHIFATIDIPSINN-ALTTTPVEEVQALATALSRDRGQDAGIATFQEYT-------VNW 387

  Fly   402 GDRTPGRKTILEYSDLFSYKYFWHGIHRTLLSRAHHAPLAPTFLYRFDFDSKHFNIMRIITCGRK 466
            ||:....|......:|.:...|.......|.....:|..|.||.|.|...|:       |.....
Zfish   388 GDKPNKEKVKQTVVELETDYMFLVPTQAALYLHTDNAKSARTFSYLFTESSR-------IPVFPL 445

  Fly   467 VRGTCHADDLSYLFYNAAAKKLKRRTAEFKTIKRLVSMVVHFAISGDPNIPMVCQDEKEQPRGAW 531
            ..|..|||:|.|:|....|..|..........|.:::...:||.:||||     :.|.:.| ..|
Zfish   446 WMGADHADELQYVFGKPFATPLGYFPRHRDVSKYMIAYWSNFAQTGDPN-----KGESKVP-VTW 504

  Fly   532 LPISKDDKVFQCLNISHDVHVIDLPEAEKLRL---WDCIY 568
            ...|...  .|.|:|::.::..::.:..:.||   |..::
Zfish   505 PEFSNPG--HQYLDINNKMNKNNVKQMLRTRLVYYWTTVF 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 165/554 (30%)
Aes <116..>221 CDD:223730 49/114 (43%)
cel.1NP_955901.2 COesterase 25..517 CDD:306613 162/533 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.