DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est8 and CES5A

DIOPT Version :9

Sequence 1:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001177087.1 Gene:CES5A / 221223 HGNCID:26459 Length:604 Species:Homo sapiens


Alignment Length:571 Identity:165/571 - (28%)
Similarity:252/571 - (44%) Gaps:146/571 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MRI-ALNYVKFKTNQQRLRSNDKVIADTVYGKVKGVKWQSIYGN----NYYSFEGIPFAKPPVGE 70
            :|| .|||    |::....|.:....:|..|.::| |..::.|:    |.  |.|:|||.||:|.
Human    41 LRIDVLNY----TSKDEGPSAEGPQRNTRLGWIQG-KQVTVLGSPVPVNV--FLGVPFAAPPLGS 98

  Fly    71 LRFKAPVEPEHWSDVKRCTHVRAKPCQVNIVLKQVQG-----------------SEDCLYLNVYT 118
            |||..|.....|.:::..|   :.|   |:.|:..:.                 ||||||||:|.
Human    99 LRFTNPQPASPWDNLREAT---SYP---NLCLQNSEWLLLDQHMLKVHYPKFGVSEDCLYLNIYA 157

  Fly   119 -RELHPHRPLPVLVWIYGGGFQMGEASRDLYSPDYI-MMEHVVLVVISYRLGALGFLSLADEELD 181
             ........||||||..||.|:.|.||  ::....: ..|.|::||:.||||..||.:..|:.  
Human   158 PAHADTGSKLPVLVWFPGGAFKTGSAS--IFDGSALAAYEDVLVVVVQYRLGIFGFFTTWDQH-- 218

  Fly   182 VPGNAGLKDQVMALRWVKRNCQFFGGDPDNITVFGESAGGASTHYMMLTDQAKGLFHKTIIMSGS 246
            .|||...||||.||.||::|.:||||||.::|:||||||..|...::|:..|||||||.|:.||.
Human   219 APGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPMAKGLFHKAIMESGV 283

  Fly   247 ALAPWAQTPTHINWPYRLAQATGYTGDANDRDIFAH-----------LKKCKASSMLKVAEDIIT 300
            |:.|:             .:|..|. .:.|..:.||           |.:|..:   |.:::::|
Human   284 AIIPY-------------LEAHDYE-KSEDLQVVAHFCGNNASDSEALLRCLRT---KPSKELLT 331

  Fly   301 MEERHQRLTMFSFGPTIEPYLTPHCVIPKSPLEMMRDCWGNSIPMVIGGNSFEGLLMFPEVNKWP 365
            :.::.:..|....|          ...|..||:::......:||.:||.|:.|...:.| :.:.|
Human   332 LSQKTKSFTRVVDG----------AFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLP-MKEAP 385

  Fly   366 ELLCQLGDCENLA-----------PQDAHVDEQQRKAFGKKVRELYFGDR---TPGRKTILEYSD 416
            |:|.  |..::||           ||..|:           |...||.|:   |..|.::|   |
Human   386 EILS--GSNKSLALHLIQNILHIPPQYLHL-----------VANEYFHDKHSLTEIRDSLL---D 434

  Fly   417 LFSYKYFWHGIHRTLLSRAHHAPLAPTFLYRFDFDSKHFNIMRIITCGRKVRGTC---------- 471
            |....:|  .:...:.:|.|....||.:.|.|    :|             |..|          
Human   435 LLGDVFF--VVPALITARYHRDAGAPVYFYEF----RH-------------RPQCFEDTKPAFVK 480

  Fly   472 --HADDLSYLFYNAAAK----KLKRRTAEFKTIKR-LVSMVVHFAISGDPN 515
              |||::.::|..|..|    ..:..|.|.|.:.| ::.....||.:|:||
Human   481 ADHADEVRFVFGGAFLKGDIVMFEGATEEEKLLSRKMMKYWATFARTGNPN 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 159/552 (29%)
Aes <116..>221 CDD:223730 48/106 (45%)
CES5ANP_001177087.1 COesterase 56..568 CDD:278561 159/552 (29%)
Aes <155..>258 CDD:223730 48/106 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142599
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.