DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est8 and cest-13

DIOPT Version :9

Sequence 1:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_741921.1 Gene:cest-13 / 181493 WormBaseID:WBGene00010116 Length:548 Species:Caenorhabditis elegans


Alignment Length:241 Identity:86/241 - (35%)
Similarity:121/241 - (50%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VIADTVY----------GKVKGVKWQSIYGNNYYSFEGIPFAKPPVGELRFKAP--------VEP 79
            |:||..|          ..::|:  |..||.   ||.||.:|:||||..||.|.        ||.
 Worm    17 VLADPTYDVTVQTPNGSATIRGI--QHTYGT---SFRGIRYAQPPVGLFRFGAARRLDPVGLVEA 76

  Fly    80 EHWSDVKRCTHVRAKPCQVNIVLKQVQGS-----EDCLYLNVYT-RELHPHRPLPVLVWIYGGGF 138
            :.:.::          |        |||.     ||||::|||| ..:.....|||.|:|:||||
 Worm    77 QAYGNI----------C--------VQGDGRTSHEDCLFINVYTPNNVTQASKLPVYVYIHGGGF 123

  Fly   139 QM--GEASRDLYSPDYIMMEHVVLVVISYRLGALGFLSLADEELDVPGNAGLKDQVMALRWVKRN 201
            ..  |.....:| |:.:....:|:|.|:||||..||.|  ..::..|||..:.|.:.||.||:|.
 Worm   124 VEGGGNMGAGIY-PNLVNKGPIVMVSINYRLGPFGFFS--TRQMTAPGNWAISDWIEALNWVQRY 185

  Fly   202 CQFFGGDPDNITVFGESAGGASTHYMMLTDQAKGLFHKTIIMSGSA 247
            ..||||||:.:|:.|:|:|..:...:.||..||.||.::|..||||
 Worm   186 ISFFGGDPNRVTIGGQSSGAEAVSTLTLTPLAKNLFKQSIHESGSA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 86/241 (36%)
Aes <116..>221 CDD:223730 43/107 (40%)
cest-13NP_741921.1 Abhydrolase 22..510 CDD:304388 83/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.