DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est8 and CEL

DIOPT Version :9

Sequence 1:NP_524259.2 Gene:alpha-Est8 / 40899 FlyBaseID:FBgn0015576 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001798.3 Gene:CEL / 1056 HGNCID:1848 Length:753 Species:Homo sapiens


Alignment Length:578 Identity:170/578 - (29%)
Similarity:253/578 - (43%) Gaps:111/578 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GKVKGV-KWQSIYGNNYYSFEGIPFAKPPVGELRFKAPVEPE-H--WSDVKRCTHVRAKPCQVNI 100
            |.|:|| |...:.|::...|:|||||.|.      ||...|: |  |....:..:.:.:..|..|
Human    31 GFVEGVNKKLGLLGDSVDIFKGIPFAAPT------KALENPQPHPGWQGTLKAKNFKKRCLQATI 89

  Fly   101 VLKQVQGSEDCLYLNVYTRE--LHPHRPLPVLVWIYGGGFQMGEA------SRDLYSPDYIMME- 156
            ......|.|||||||::..:  ....|.|||::|||||.|.||..      :..||..:.|... 
Human    90 TQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRG 154

  Fly   157 HVVLVVISYRLGALGFLSLADEELDVPGNAGLKDQVMALRWVKRNCQFFGGDPDNITVFGESAGG 221
            :|::|..:||:|.|||||..|..|  |||.||:||.||:.|||||...|||||:|||:|||||||
Human   155 NVIVVTFNYRVGPLGFLSTGDANL--PGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGG 217

  Fly   222 ASTHYMMLTDQAKGLFHKTIIMSGSALAPWAQTPTHINWPYRLAQATGY-TGDANDRDIFAHLKK 285
            ||.....|:...|||..:.|..||.||:||......:.|..::|:..|. .|||      |.:.:
Human   218 ASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDA------ARMAQ 276

  Fly   286 CKASSMLKVAED-IITMEER-------HQRLTMFSFGPTIEPYLTPHCVIPKSPLEMMRDCWGNS 342
            |     |||.:. .:|:..:       :..|....|.|.|:...     ||..|:.:    :.|:
Human   277 C-----LKVTDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDF-----IPADPINL----YANA 327

  Fly   343 --IPMVIGGNSFEGLLM----FPEVNKWPELLCQLGDCENLAPQDAHVDEQQRKAFGKKVRELYF 401
              |..:.|.|:.:|.:.    .|.:||                .:..|.|:.   |.|.|.|...
Human   328 ADIDYIAGTNNMDGHIFASIDMPAINK----------------GNKKVTEED---FYKLVSEFTI 373

  Fly   402 GDRTPGRKTILE-YSDLFSYKYFWHGIHRTL--------------LSRAHH---APLAPTFLYRF 448
            .....|.||..: |::.::.........:|:              ::.|.|   |..|.|:.|.|
Human   374 TKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLF 438

  Fly   449 DFDSKHFNIMRIITCGRKVRGTCHADDLSYLFYNAAAKKLKRRTAEFKTIKRLVSMVVHFAISGD 513
            ...|:    |.:..   |..|..||||:.|:|....|.....|..:....|.:::...:||.:||
Human   439 SHPSR----MPVYP---KWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGD 496

  Fly   514 PNIPMVCQDEKEQPRGAWLPISKDDKVFQCLNISHDVHVIDLPEAEK---LRLWDCIY 568
            ||:     .:...|. .|.|.:.::..:  |.|:..:....:..:.:   ||.|...|
Human   497 PNM-----GDSAVPT-HWEPYTTENSGY--LEITKKMGSSSMKRSLRTNFLRYWTLTY 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est8NP_524259.2 COesterase 29..564 CDD:278561 168/572 (29%)
Aes <116..>221 CDD:223730 54/113 (48%)
CELNP_001798.3 Heparin-binding 21..121 31/95 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..753
17 X 11 AA tandem repeats, glycodomain, O-linked (mucin type) 559..745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142718
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222591at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.