DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mics1 and AT5G47130

DIOPT Version :9

Sequence 1:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001332047.1 Gene:AT5G47130 / 834759 AraportID:AT5G47130 Length:226 Species:Arabidopsis thaliana


Alignment Length:256 Identity:62/256 - (24%)
Similarity:106/256 - (41%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DHSMVWPQYVRDRIHATYAYFGASCGVTAASAVAFFQSDAMMAL-----MTRSGWVASL------ 184
            |.|.:.|..   :.|....||...| :.||||   |.:...|.|     :|:.|||.||      
plant     6 DFSRISPAI---QSHLMRVYFSLFC-ILAASA---FGAYLHMRLNIGGTITKLGWVLSLLEHVVS 63

  Fly   185 -------VTLGLVMLSGSIAQGLEYQPGFGAKQLAWLVHCAVLGAVLAPMCLLGGPILTKALLYT 242
                   :...|::|.|                   ::|.|.:|..:.....:...||..|.|.|
plant    64 CPPYKHKIRFSLLLLFG-------------------VLHGASVGPCIKSTIDIDSSILITAFLGT 109

  Fly   243 SGIVGALSTVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSLYGGLILF 307
            :.|....|.||..|...:::::||.|:.|..::       .||..:....:....:.:|.||:||
plant   110 AVIFFCFSAVAMLARRREYIYLGGLLSSGFSLL-------TWLKNSDQFASATVEIQMYLGLLLF 167

  Fly   308 SGFLLYDTQRIVKSAELYPQYSKFPYDPINHALAIYMDALNIFIRIAIIL---AGDQKRKN 365
            .|.::.:||.|::.|.....      |...|:|.:|:..:.:|::|..|:   :.|:.|:|
plant   168 VGCIVVNTQEIIEKAHCGDM------DYAVHSLILYIGFVRVFLQILSIMWNTSADRIRRN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mics1NP_649725.2 GHITM 116..364 CDD:198413 60/253 (24%)
AT5G47130NP_001332047.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.