DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mics1 and AT4G15470

DIOPT Version :9

Sequence 1:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_567466.1 Gene:AT4G15470 / 827218 AraportID:AT4G15470 Length:256 Species:Arabidopsis thaliana


Alignment Length:278 Identity:62/278 - (22%)
Similarity:105/278 - (37%) Gaps:100/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MMGPPSENAYSMGKGAAAGAALMGLVGLCYYGLGLANQPSIYDHSMVWPQYVRDRIHATYAYFGA 153
            ::.||..:..:...|.        |:.||           |....::||.::..:.|.       
plant    72 VLNPPVNDLLTGSPGI--------LLFLC-----------IVPFILIWPLHIYHQKHP------- 110

  Fly   154 SCGVTAASAVAFFQSDAMMALMTRSGWVASLVTLGLVMLSGSIAQGLEYQPGFGAKQLAWLVHCA 218
                                        .:|:.|.|..:|.|...|               |.||
plant   111 ----------------------------VNLILLALFTVSLSFTVG---------------VSCA 132

  Fly   219 VLGAVLAPMCLLGGPILTKALLYTSGIVGALS--TVAACAPSEKFLHMGGPLAIGLGVVFASSLA 281
                      :..|.|:.:||:.|..:||:|:  |..|....:.|..:|..|...|.::..:|..
plant   133 ----------MTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSFI 187

  Fly   282 SMWLPPTTAVGAGLASMSLYGGL--ILFSGFLLYDTQRIVKSAELYPQYSKFPYDP-INHALAIY 343
            .|:.|      .|..|:::|||.  ::|.|:::|||..::|         :|.||. |..::|:|
plant   188 QMFFP------LGPTSVAVYGGFSALVFCGYIVYDTDNLIK---------RFTYDEYILASVALY 237

  Fly   344 MDALNIFIRIAIIL-AGD 360
            :|.||:|:.|..|| .||
plant   238 LDILNLFLTILRILRQGD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mics1NP_649725.2 GHITM 116..364 CDD:198413 58/251 (23%)
AT4G15470NP_567466.1 GAAP_like 16..255 CDD:198411 60/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23291
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.