DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mics1 and CG30379

DIOPT Version :9

Sequence 1:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_724626.2 Gene:CG30379 / 246578 FlyBaseID:FBgn0050379 Length:295 Species:Drosophila melanogaster


Alignment Length:135 Identity:37/135 - (27%)
Similarity:58/135 - (42%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ILTKALLYTSGIVGALSTVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLP------PTTAVG 292
            ::..|:..|:.:|.||| :.|......:...||.:...:.::...|:..:|:|      |.|.  
  Fly   177 VVISAVAITTLLVIALS-IYAVQTKYDYTAAGGVILTFVIILIVLSVCGVWMPDFVDSLPITC-- 238

  Fly   293 AGLASMSLYGGLILFSG--FLLYDTQRIV---KSAELYPQYSKFPYDPINHALAIYMDALNIFIR 352
                       |..|.|  ||:.|.|.||   :|.:|.|:...|.      ||.:|:|.:.|||.
  Fly   239 -----------LCTFIGCFFLIADMQSIVGGNRSEQLDPEEYVFA------ALTLYVDVVRIFIY 286

  Fly   353 IAIIL 357
            |..||
  Fly   287 ILRIL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mics1NP_649725.2 GHITM 116..364 CDD:198413 37/135 (27%)
CG30379NP_724626.2 LFG_like 76..291 CDD:198410 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.