DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and NLGN2

DIOPT Version :9

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:630 Identity:165/630 - (26%)
Similarity:256/630 - (40%) Gaps:171/630 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VVSTTYGPIKGVKRK---SIYGQSYFSFERIPFAKPPVGELRYKAPQPPEVWTEVRSCTSQGPK- 93
            ||:|.||.::||:|:   .|.| ....|..:|:|.||:|..|::.|:.|..|..||:.|:..|. 
Human    43 VVNTAYGRVRGVRRELNNEILG-PVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPAC 106

  Fly    94 PLQKHFVFE-------MTDG-----------SEDCLYLNVYTKNLYPTK--PM------------ 126
            |...|....       .||.           ||||||||:|.    ||:  |:            
Human   107 PQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYV----PTEDGPLTKKRDEATLNPP 167

  Fly   127 ----------PVMVWIYGGGFQFGEASRECYSPDYLLR-EDVVVISINYRLGPLGTNDDTWKKKH 180
                      |||::::||.:.  |.:...:....|.. .:|:|.::|||||.|           
Human   168 DTDIRDPGKKPVMLFLHGGSYM--EGTGNMFDGSVLAAYGNVIVATLNYRLGVL----------- 219

  Fly   181 IFNISLPGFLCLDDPELDVPGNAGLKDQVLALRWVKANCSRFGGDSANITIFGDSAGSASVHYMM 245
                   |||...|..  ..||.||.||:.||||:..|.:.||||...|||||..||::.|:.::
Human   220 -------GFLSTGDQA--AKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLI 275

  Fly   246 ITEQTHGLFHKAICMSGNTLSPWAVTPQRNWPYR----LAVQAGYAGENNTRDVWEFLKNAKGSE 306
            ::..:.|||.|||..||..:|.|:|..|   |.:    ||.:.|...|::...| |.|:.     
Human   276 LSHHSEGLFQKAIAQSGTAISSWSVNYQ---PLKYTRLLAAKVGCDREDSAEAV-ECLRR----- 331

  Fly   307 IIKANGELCIDEEKKERIGFSFGPVIEPYVTSHCVVPKKPIEMMRTAWSNNIPLIIGGVSNEGLL 371
              |.:.||...:.:..|...:||||::     ..|||..|..:|:.....|..::||....|||.
Human   332 --KPSRELVDQDVQPARYHIAFGPVVD-----GDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLK 389

  Fly   372 LYSETKTNPK---------CLNELDDCRFVVPIELNMDRESA-------LCREYGDQLRQCYYGD 420
            ...::..:..         .::...|..:..|...::.||:.       ..|:.|:..|:...  
Human   390 FVEDSAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMRRKTLL-- 452

  Fly   421 KTPSLDTLHEYLQMVSHEYFWFPIYRTVLSRLQYARSAPTYLYRFDFDSKHFNHLRILSCGKKVR 485
               :|.|.|:::.         |...|......|  .:|.|.|.|      ::|     |..:.|
Human   453 ---ALFTDHQWVA---------PAVATAKLHADY--QSPVYFYTF------YHH-----CQAEGR 492

  Fly   486 ----GTCHGDDLSYLFYNSLARKLK----NHTREYKCIERLV-GLWTHFAACGNPNFDPEQEDLW 541
                ...|||:|.|:|...:.....    |.::....:..:| ..||:||..|:||         
Human   493 PEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPN--------- 548

  Fly   542 QPVDPAAVEKHQLKCLNISDELKVIDV-PDLKKLMVWESFFRRDE 585
            |||               ..:.|.|.. |:..:.:||..|..:::
Human   549 QPV---------------PQDTKFIHTKPNRFEEVVWSKFNSKEK 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 33..555 CDD:278561 159/597 (27%)
Aes <115..>237 CDD:223730 43/146 (29%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 165/630 (26%)
Aes <170..>268 CDD:223730 40/119 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.