DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:368 Identity:71/368 - (19%)
Similarity:126/368 - (34%) Gaps:111/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KHFVFEMTDGSEDCLYLNVYTK---NLYPTKPMPVMVWIYGGGFQFGEASRECYSPDYLLRE-DV 157
            ||:|..:|.|... ..|::|..   .|....|:||:|::|||.:..|:.|..|.....:.:| :.
Zfish    87 KHYVKGITFGRRG-NKLDLYYSPRLELSDESPVPVVVFVYGGAWGSGDRSIYCLLALQMAKELNA 150

  Fly   158 VVISINYRLGPLGTNDDTWKKKHIFNISLPGFLCLDDPELDVPGNAGLKDQVLALRWVKANCSRF 222
            .||..:|.:.|.|         ::.|:                    ::|...:|.||:.....|
Zfish   151 SVICPDYSIYPKG---------NVLNM--------------------VQDISDSLLWVRQKGHAF 186

  Fly   223 GGDSANITIFGDSAGSASVHYMMITEQTHGLFHKAICMSGNTLSPWAVTPQRNWPYRLAVQAGYA 287
            ..|..||.:.|.|||:   |...:|         ::.::.|                  |:..:.
Zfish   187 SLDQDNIILIGHSAGA---HLCALT---------SLFLASN------------------VEELFI 221

  Fly   288 GENNTRDVWEFLKNAKGSEIIKANGELCI-DEEKKERIGFSFGPVIEPYVTSHCVV--------- 342
            ..|..:|:...:|.     ||..:|...| |....|::     ..:|...|.|..:         
Zfish   222 ETNKQKDLVTAIKG-----IIGLSGVYSIMDHYNHEKV-----RAVEYVSTMHKAMDGVENFDYY 276

  Fly   343 -PKKPIEMMRTAWSNNIP--LIIGGVSN-----EGLLLYSETKTNPKCLNELDDCRFVVPIELNM 399
             |...::.|:......:|  .:..|.::     |..:.:||..|:......|    :::|...:.
Zfish   277 SPTSLLKKMKEDQLKRVPPMALFHGTNDIIVPVESSVRFSELLTSLSIRMSL----YLIPKMNHT 337

  Fly   400 DRESALCREYGDQLRQCYYGDKTPSLDTLHEYLQMVSHEYFWF 442
            |..:.|               ..|.....|.....:.|||..|
Zfish   338 DMVTDL---------------MAPDRHFYHTVYGCIKHEYSKF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 33..555 CDD:278561 71/368 (19%)
Aes <115..>237 CDD:223730 29/125 (23%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 63/322 (20%)
Abhydrolase 121..>210 CDD:304388 28/129 (22%)
Abhydrolase 167..336 CDD:304388 39/232 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.