DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and AADACL4

DIOPT Version :10

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001013652.1 Gene:AADACL4 / 343066 HGNCID:32038 Length:407 Species:Homo sapiens


Alignment Length:123 Identity:31/123 - (25%)
Similarity:53/123 - (43%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TKPMPVMVWIYGGGFQFGEASRECYSP--DYLLRE-DVVVISINYRLGPLGTNDDTWKKKHIFNI 184
            ::|...:::.:||...||  |.:||..  :||.|| :.|::.|.||                   
Human   109 SRPRRGIIFYHGGATVFG--SLDCYHGLCNYLARETESVLLMIGYR------------------- 152

  Fly   185 SLPGFLCLDDPELDVPGNAGLKDQVLA-LRWVKANCSRFGGDSANITIFGDSAGSASV 241
            .||          |....|..:|.:.| :.::|| ...:|.|.:.:.:.|:|.|.|:|
Human   153 KLP----------DHHSPALFQDCMNASIHFLKA-LETYGVDPSRVVVCGESVGGAAV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 32..577 CDD:395084 31/123 (25%)
AADACL4NP_001013652.1 alpha/beta hydrolases 115..378 CDD:473884 30/117 (26%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 0/1 (0%)

Return to query results.
Submit another query.