DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and CG30095

DIOPT Version :9

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:123 Identity:26/123 - (21%)
Similarity:47/123 - (38%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 VLSRLQYARSAPTYLYRFDFDSKHFNHLRILSCGKKVRGT---CHGDDLSYLFY--NSLARKLKN 507
            ::|.|::.|   |:|:.|        |:..:.|....:|.   ..|    ::.|  ::.||...|
  Fly    54 LISSLEHQR---TFLHLF--------HVPYIICFYAAKGKWPYVPG----FMKYRVDNAARSFFN 103

  Fly   508 HTREYKCIERLVGLWTHFAACGNPNFDPEQE-DLWQPVDPAAVEKHQLKC--LNISDE 562
            ....:  |::....|.....|..|.||.... |:......|.::..:..|  |.:|.|
  Fly   104 QNDSF--IKQFCTKWIQVKECFRPLFDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 33..555 CDD:278561 22/112 (20%)
Aes <115..>237 CDD:223730
CG30095NP_725529.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.