DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and LOC1278331

DIOPT Version :10

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_317954.5 Gene:LOC1278331 / 1278331 VectorBaseID:AGAMI1_014970 Length:147 Species:Anopheles gambiae


Alignment Length:69 Identity:20/69 - (28%)
Similarity:32/69 - (46%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 RFDFDSKHFNHLRILSCGKKVRGTCHGDDLSYLF-YNSLARKLKNHTREYKCIERLVGLWTHFAA 527
            ||.:| :..:|:....      |..|.:||.||| |...|.:|  :..:....:::|.||:.|..
Mosquito     8 RFGYD-QDISHIPFDG------GVHHTNDLLYLFPYPPTAAQL--NEPDTAMAKKMVDLWSSFIV 63

  Fly   528 CGNP 531
            .|.|
Mosquito    64 EGVP 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 32..577 CDD:395084 20/69 (29%)
LOC1278331XP_317954.5 None

Return to query results.
Submit another query.