DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est9 and clt

DIOPT Version :9

Sequence 1:NP_731165.2 Gene:alpha-Est9 / 40897 FlyBaseID:FBgn0015577 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_536784.1 Gene:clt / 117300 FlyBaseID:FBgn0000326 Length:562 Species:Drosophila melanogaster


Alignment Length:572 Identity:186/572 - (32%)
Similarity:292/572 - (51%) Gaps:48/572 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RYRTSEKTVVSTTYGPIKGVKRKSIYGQSYFSFERIPFAKPPVGELRYKAPQPPEVWTEVR-SCT 88
            |:.:|.|..|....|.:.|.::|.:.|..|.||..:|:|:|||||||:::|:|.|.:.:.. .|:
  Fly    13 RFCSSMKVKVPVKQGVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRFRSPRPLERFQKQELDCS 77

  Fly    89 SQGPKPLQKH-FVFEMTDGSEDCLYLNVYTKNLYPTK-PMPVMVWIYGGGFQFGEASRECYSPDY 151
            .:|....|:. |..|:. ||||||:||||...:..|: |:||||||:||||.||..:.:.:.|..
  Fly    78 KEGNVSYQRDPFTLEVA-GSEDCLFLNVYAPKVKSTRTPLPVMVWIHGGGFFFGNGNSDFHFPAK 141

  Fly   152 LLREDVVVISINYRLGPLGTNDDTWKKKHIFNISLPGFLCLDDPELDVPGNAGLKDQVLALRWVK 216
            |:.::|:|:::|||||.|                  |||.|  ||..:.||.|||||.|||.||:
  Fly   142 LMEQEVIVVTLNYRLGAL------------------GFLSL--PEEGIHGNMGLKDQRLALEWVQ 186

  Fly   217 ANCSRFGGDSANITIFGDSAGSASVHYMMITEQTHGLFHKAICMSGNTLSPWAVTPQRNWP---Y 278
            .|.:.|.||..|:|:||:|||.:|||..........||||||..||.....|..  |...|   .
  Fly   187 ENIASFNGDPNNVTLFGESAGGSSVHLHTFARHAKRLFHKAIMQSGTANMEWVF--QNEAPAKTR 249

  Fly   279 RLAVQAG---YAGENNTRDVWEFLKNAKGS-EIIKANG-ELCIDEEKKERIGFSFGPVIEPYVTS 338
            |||...|   :.|:  ::.:..||::.|.: ..|.||. ::...:|::..:.|:|.||:|...:.
  Fly   250 RLAELLGGGDFGGD--SKALLTFLQSEKATPTAILANTLKVLSPDERRRHLPFAFKPVVEDSSSP 312

  Fly   339 HCVVPKKPIEMM-RTAWSNNIPLIIGGVSNEGLLLYSETKTNPKCLNELDDCRFVVPIELNMDRE 402
            ...:.:..:|:| :.....::|:|:|..|.|||.:..:.|...:...  ||...:||..|.:|.:
  Fly   313 DRFLEQDIMELMHKKDCLGSMPVIMGYNSAEGLAIVVKAKQKLEAYE--DDLARLVPRNLVLDPQ 375

  Fly   403 SALCREYGDQLRQCYYGDKTPSLDTLHEYLQMVSHEYFWFPIYRTVLSRLQYARSAPTYLYRFDF 467
            :...:|....:|..::..:..|.:.:...:.:.|..:|...:.|.|.........:|.|.||.|:
  Fly   376 APEAQEAASDIRAFFFNGQALSKENMDNLVDLFSDYHFSMDLQRAVEIHASCQTQSPLYFYRLDY 440

  Fly   468 DSKHFNHLRILSCGKKVRGTCHGDDLSYLFYNSLARKLKNHTREYKCIERLVGLWTHFAACGNPN 532
            ......:.:|.. .:.:||..|.||:.||| .....:.:.:..:....|||..:|.:||..|.|:
  Fly   441 VGGRNLYKKIFQ-NEDLRGVAHADDICYLF-QMAGDETEMNRDDLMVTERLCEMWANFARDGKPS 503

  Fly   533 FDPEQEDLWQPV-DPAAVEKHQLKCLNISDELKVIDVPDLKKLMVWESFFRR 583
                  .:|:|| .|...|..||.||.|..|||:...||.:::..|.|.:||
  Fly   504 ------PIWKPVKKPHNGEPIQLDCLLIDRELKMCSNPDGERMDFWRSMYRR 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est9NP_731165.2 COesterase 33..555 CDD:278561 170/534 (32%)
Aes <115..>237 CDD:223730 53/122 (43%)
cltNP_536784.1 COesterase 22..543 CDD:278561 179/555 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 222 1.000 Domainoid score I1478
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I2231
Isobase 1 0.950 - 0 Normalized mean entropy S4412
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
87.810

Return to query results.
Submit another query.