DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Est10 and NCEH1

DIOPT Version :10

Sequence 1:NP_001246962.1 Gene:alpha-Est10 / 40896 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001139748.2 Gene:NCEH1 / 57552 HGNCID:29260 Length:416 Species:Homo sapiens


Alignment Length:127 Identity:31/127 - (24%)
Similarity:64/127 - (50%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 DCLYLNVYVKDLQPDK-LRPVMVWIYGGGYQVGEASRDMYSPD----FF------MSKDV--VIV 177
            |.:.:.|:....:|:: |:..:|:|:|||:.:..||.. :||.    ::      |::::  |||
Human    88 DGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASASAS-WSPSDEIRYYDELCTAMAEELNAVIV 151

  Fly   178 TVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWV--QQNIEAFGGDSNNITLFGESAGG 237
            ::.|||         .|::..|..  :.|.:.|.::.  .:.::.:..|...|.:.|:||||
Human   152 SIEYRL---------VPKVYFPEQ--IHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..533 CDD:395084 31/127 (24%)
NCEH1NP_001139748.2 Abhydrolase_3 109..389 CDD:400284 27/106 (25%)

Return to query results.
Submit another query.